Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 6 (TVA6)

This Recombinant Human T cell receptor alpha variable 6 (TVA6) spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 6 TRAV6 TCRAV5S1

UniProt

A0A075B6T7

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SLC25A51 (Solute carrier family 25 member 51) Expressed in vitro E.coli expression system, Full Length
MPX2684K Each

Magic™ Membrane Protein Human SLC25A51 (Solute carrier family 25 member 51) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
MTD Strip
ABT-DOA-A30 50 Tests

MTD Strip

Sign In for Pricing
View Details
CHRND Rabbit pAb
A10467 200 µL

CHRND Rabbit pAb

Sign In for Pricing
View Details
casein kinase Iα Lentiviral Activation Particles (m2)
sc-429998-LAC-2 200 µL

casein kinase Iα Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-A (FCGR2A) Antibody
abx421831-01 50 µg

Low Affinity Immunoglobulin Gamma Fc Region Receptor II-A (FCGR2A) Antibody

Sign In for Pricing
View Details
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-A (FCGR2A) Antibody
abx421831-02 100 µg

Low Affinity Immunoglobulin Gamma Fc Region Receptor II-A (FCGR2A) Antibody

Sign In for Pricing
View Details