Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91)

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-2 Microglobulin (B2M) (BBM.1), CF488A conjugate, 0.1mg/mL
BNC880142-100 1x 100 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Hydroxypiperidine-d9
TRC-H950847-250MG 250 mg

4-Hydroxypiperidine-d9

Sign In for Pricing
View Details
Cd44 Rat Monoclonal Antibody [Clone ID: IM7.8.1]
CL024FX 300 µg

Cd44 Rat Monoclonal Antibody [Clone ID: IM7.8.1]

Sign In for Pricing
View Details
SRP9 (NM_003133) Human Recombinant Protein
TP321573 20 µg

SRP9 (NM_003133) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562930 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
(S)-3-Amino-3-phenylpropan-1-ol
TRC-A634770-10MG 10 mg

(S)-3-Amino-3-phenylpropan-1-ol

Sign In for Pricing
View Details