Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91)

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACRBP Recombinant Protein (Human)
RP045700 100 µg

ACRBP Recombinant Protein (Human)

Sign In for Pricing
View Details
PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly (A) -binding protein type II, Poly (A) -binding protein nuclear-like 1) (Azide free) (HRP) discontinued
039603-HRP 200 µL

PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly (A) -binding protein type II, Poly (A) -binding protein nuclear-like 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
SMAP2 siRNA (Human)
orb1856202-01 15 nmol

SMAP2 siRNA (Human)

Sign In for Pricing
View Details
SMAP2 siRNA (Human)
orb1856202-02 30 nmol

SMAP2 siRNA (Human)

Sign In for Pricing
View Details
Aggf1 Mouse shRNA Plasmid (Locus ID 66549)
TL503657 1 Kit

Aggf1 Mouse shRNA Plasmid (Locus ID 66549)

Sign In for Pricing
View Details
Dyrk1b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3398604 1.0 µg DNA

Dyrk1b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details