Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23)

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23) spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDH Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1593855 100 µL

GAPDH Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
WBP1 ORF Vector (Human) (pORF)
50272011 1.0 µg DNA

WBP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Phospho-NMDAR2A (Tyr943) Antibody
AF7362-01 100 µL

Phospho-NMDAR2A (Tyr943) Antibody

Sign In for Pricing
View Details
Phospho-NMDAR2A (Tyr943) Antibody
AF7362-02 200 µL

Phospho-NMDAR2A (Tyr943) Antibody

Sign In for Pricing
View Details
OmpA Antibody, FITC conjugated
CSB-PA16479C0Rb-01 50 µg

OmpA Antibody, FITC conjugated

Sign In for Pricing
View Details
OmpA Antibody, FITC conjugated
CSB-PA16479C0Rb-02 100 µg

OmpA Antibody, FITC conjugated

Sign In for Pricing
View Details