Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 18 (TVA18)

This Recombinant Human T cell receptor alpha variable 18 (TVA18) spans the amino acid sequence from region 21-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 18 TRAV18

UniProt

A0A075B6X5

Expression Region

21-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQTEGPVTLPERAALTLNCTYQSSYSTFLFWYVQYLNKEPELLLKSSENQETDSRGFQASPIKSDSSFHLEKPSVQLSDSAVYYCALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin alpha5 Polyclonal Antibody
E-AB-31903-01 20 µL

Laminin alpha5 Polyclonal Antibody

Sign In for Pricing
View Details
Laminin alpha5 Polyclonal Antibody
E-AB-31903-02 60 µL

Laminin alpha5 Polyclonal Antibody

Sign In for Pricing
View Details
Laminin alpha5 Polyclonal Antibody
E-AB-31903-03 120 µL

Laminin alpha5 Polyclonal Antibody

Sign In for Pricing
View Details
Laminin alpha5 Polyclonal Antibody
E-AB-31903-04 200 µL

Laminin alpha5 Polyclonal Antibody

Sign In for Pricing
View Details
FGF21 Protein, Human, Recombinant (N-mFc-Avi)
E51P01967 100 µg

FGF21 Protein, Human, Recombinant (N-mFc-Avi)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Perilipin 4 (PLIN4)
MBS2095636-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Perilipin 4 (PLIN4)

Sign In for Pricing
View Details