Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545)

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSN1 Rabbit Polyclonal Antibody (APC)
orb2421220 100 µL

DSN1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
APC/XFD750 Anti-human/monkey CD154 Antibody *5C8*
115401E0-AAT 25 Tests

APC/XFD750 Anti-human/monkey CD154 Antibody *5C8*

Sign In for Pricing
View Details
Human ART1 protein
orb244031-01 20 µg

Human ART1 protein

Sign In for Pricing
View Details
Human ART1 protein
orb244031-02 100 µg

Human ART1 protein

Sign In for Pricing
View Details
Human ART1 protein
orb244031-03 1 mg

Human ART1 protein

Sign In for Pricing
View Details
GAP43 Antibody
C40202-01 50 μL

GAP43 Antibody

Sign In for Pricing
View Details