Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS20 Recombinant Antibody, PE-Cy5 Conjugated
bsm-60503R-PE-Cy5 100 µL

RPS20 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Human SCN4A Protein Lysate
MBS8419115-01 0.02 mg

Human SCN4A Protein Lysate

Sign In for Pricing
View Details
Human SCN4A Protein Lysate
MBS8419115-02 5x 0.02 mg

Human SCN4A Protein Lysate

Sign In for Pricing
View Details
Mouse A Disintegrin And Metalloprotease 8,ADAM8 Elisa Kit
EK730012 96 Well

Mouse A Disintegrin And Metalloprotease 8,ADAM8 Elisa Kit

Sign In for Pricing
View Details
XAB1 (GPN-loop GTPase 1, XPA-binding Protein 1, MBD2-interacting Protein, GPN1, MBDIN (Azide Free) (MaxLight 550)
MBS6209831-01 0.1 mL

XAB1 (GPN-loop GTPase 1, XPA-binding Protein 1, MBD2-interacting Protein, GPN1, MBDIN (Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
XAB1 (GPN-loop GTPase 1, XPA-binding Protein 1, MBD2-interacting Protein, GPN1, MBDIN (Azide Free) (MaxLight 550)
MBS6209831-02 5x 0.1 mL

XAB1 (GPN-loop GTPase 1, XPA-binding Protein 1, MBD2-interacting Protein, GPN1, MBDIN (Azide Free) (MaxLight 550)

Sign In for Pricing
View Details