Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhpn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6103008 1.0 µg DNA

Rhpn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
LCE1B AAV Vector (Human) (CMV)
26344101 1 µg

LCE1B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MARK2 (B-1) : m-IgG1 BP-HRP Bundle
sc-532737 1 Kit

MARK2 (B-1) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
MSP-C4 5um 5cm x 3.0mm - EACH
CHR5008 1 Each

MSP-C4 5um 5cm x 3.0mm - EACH

Sign In for Pricing
View Details
Entpd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
19320116 3x 1.0 µg

Entpd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ELOVL6 Polyclonal Antibody
UB-GEN-2573 100 µL

ELOVL6 Polyclonal Antibody

Sign In for Pricing
View Details