Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK6 Knockout THP-1 Polyclonal Cells
ARG7392 1 Million

CDK6 Knockout THP-1 Polyclonal Cells

Sign In for Pricing
View Details
BUD13 CRISPRa sgRNA lentivector (set of three targets)(Rat)
13583126 3x 1.0µg DNA

BUD13 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
LRRC14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1232907 1.0 µg DNA

LRRC14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
4-Methyl-2-pentanol
OR1078776-01 25 mL

4-Methyl-2-pentanol

Sign In for Pricing
View Details
4-Methyl-2-pentanol
OR1078776-02 500 mL

4-Methyl-2-pentanol

Sign In for Pricing
View Details
ZWINT Antibody
E308076 200 µL

ZWINT Antibody

Sign In for Pricing
View Details