Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP4-9 Adenovirus (Human)
26193051 1.0 mL

KRTAP4-9 Adenovirus (Human)

Sign In for Pricing
View Details
Akt Polyclonal Antibody
E44H01499 100 µL

Akt Polyclonal Antibody

Sign In for Pricing
View Details
B4GALNT3 Rabbit Polyclonal Antibody (FITC)
orb2113479 100 µL

B4GALNT3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RAB8B rabbit pAb
ES10134-01 50 µL

RAB8B rabbit pAb

Sign In for Pricing
View Details
RAB8B rabbit pAb
ES10134-02 100 µL

RAB8B rabbit pAb

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase CHFR (C-His)
BP2843-500ug 500 µg

Recombinant Human E3 ubiquitin-protein ligase CHFR (C-His)

Sign In for Pricing
View Details