Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBA2 Human
PT-A02322-01 5 µg

HBA2 Human

Sign In for Pricing
View Details
HBA2 Human
PT-A02322-02 20 µg

HBA2 Human

Sign In for Pricing
View Details
HBA2 Human
PT-A02322-03 1 mg

HBA2 Human

Sign In for Pricing
View Details
3'-Hydroxypterostilbene
A4685-10 10 mg

3'-Hydroxypterostilbene

Sign In for Pricing
View Details
CGS-187-2-WT-2 AB Labels
149649 Roll of 5000 Piece(s)

CGS-187-2-WT-2 AB Labels

Sign In for Pricing
View Details
Anti-ARFGAP1 Antibody Picoband® (APC Conjugate)
A04959-APC 100 µg/Vial

Anti-ARFGAP1 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details