Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30)

This Recombinant Human T cell receptor alpha variable 30 (TVA30) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1rl Mouse Gene Knockout Kit (CRISPR)
KN502360 1 Kit

C1rl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL
BNC471555-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyanine-3- dUTP [Cy3-dUTP] *1 mM in TE Buffer (pH 7.5) *
17025-AAT 25 nmoles

Cyanine-3- dUTP [Cy3-dUTP] *1 mM in TE Buffer (pH 7.5) *

Sign In for Pricing
View Details
PLSCR4 (NM_001128304) Human Over-expression Lysate
LY426943 100 µg

PLSCR4 (NM_001128304) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS706859 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
GPR84 (NM_020370) Human Over-expression Lysate
LC402776 20 µg

GPR84 (NM_020370) Human Over-expression Lysate

Sign In for Pricing
View Details