Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30)

This Recombinant Human T cell receptor alpha variable 30 (TVA30) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS805595 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF647 conjugate, 0.1mg/mL
BNC471952-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Phenyl Phosphate Dibasic Dihydrate
TRC-S673270-500MG 500 mg

Sodium Phenyl Phosphate Dibasic Dihydrate

Sign In for Pricing
View Details
Myoglobin (MB) (NM_203378) Human Over-expression Lysate
LC404320 20 µg

Myoglobin (MB) (NM_203378) Human Over-expression Lysate

Sign In for Pricing
View Details
CKAP1 (TBCB) Mouse Monoclonal Antibody [Clone ID: AT1F6]
AM50094PU-N 100 µL

CKAP1 (TBCB) Mouse Monoclonal Antibody [Clone ID: AT1F6]

Sign In for Pricing
View Details
cis-Heptachlor Epoxide
TRC-H265700-1MG 1 mg

cis-Heptachlor Epoxide

Sign In for Pricing
View Details