Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30)

This Recombinant Human T cell receptor alpha variable 30 (TVA30) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S172 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV743813 1.0 µg DNA

RN5S172 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human KDM5B shRNA (UAS) - Lentiviral human KDM5B shRNA (UAS) (100)
GTR15325857 1 Vial

Lentiviral human KDM5B shRNA (UAS) - Lentiviral human KDM5B shRNA (UAS) (100)

Sign In for Pricing
View Details
Boc-N-Me-Tyr (tBu) -OH
CSB-DT2444 1 g

Boc-N-Me-Tyr (tBu) -OH

Sign In for Pricing
View Details
Mouse Transmembrane gamma-carboxyglutamic acid protein 4 ELISA Kit
MBS2882652-01 48 Well

Mouse Transmembrane gamma-carboxyglutamic acid protein 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane gamma-carboxyglutamic acid protein 4 ELISA Kit
MBS2882652-02 96 Well

Mouse Transmembrane gamma-carboxyglutamic acid protein 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane gamma-carboxyglutamic acid protein 4 ELISA Kit
MBS2882652-03 5x 96 Well

Mouse Transmembrane gamma-carboxyglutamic acid protein 4 ELISA Kit

Sign In for Pricing
View Details