Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCK Polyclonal Antibody
RA25256-01 50 µL

GCK Polyclonal Antibody

Sign In for Pricing
View Details
GCK Polyclonal Antibody
RA25256-02 100 µL

GCK Polyclonal Antibody

Sign In for Pricing
View Details
Human EIF5AL1 qPCR Primer Pair
QH63881S 200 Tests

Human EIF5AL1 qPCR Primer Pair

Sign In for Pricing
View Details
RNU6-38 CRISPR All-in-one AAV vector set (with saCas9)(Human)
40460151 3x 1.0 µg DNA

RNU6-38 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Phospho-BLNK (Tyr96) Antibody
E18-3467-1 50 µg - 50 µL

Phospho-BLNK (Tyr96) Antibody

Sign In for Pricing
View Details
RUNX1 Rabbit pAb
E47R2744 100 µL

RUNX1 Rabbit pAb

Sign In for Pricing
View Details