Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16)

This Recombinant Human T cell receptor beta variable 16 (TVB16) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gsdmc4 Rabbit Polyclonal Antibody
TA363522 100 µL

Gsdmc4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Higd1a (NM_019814) Mouse Tagged ORF Clone
MG200252 10 µg

Higd1a (NM_019814) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon
CP565765 150 µg

Tissue Protein Lysate, Colon

Sign In for Pricing
View Details
Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]
TA504037AM 100 µL

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details
PITPNM2 (NM_020845) Human Recombinant Protein
TP316422M 100 µg

PITPNM2 (NM_020845) Human Recombinant Protein

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: OTI2C5]
CF808779 100 µg

ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: OTI2C5]

Sign In for Pricing
View Details