Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16)

This Recombinant Human T cell receptor beta variable 16 (TVB16) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog EGF / Pro-epidermal growth factor Recombinant Protein
R0560d 1 Each

Dog EGF / Pro-epidermal growth factor Recombinant Protein

Sign In for Pricing
View Details
Phospho-MDM2 (Ser188 + Ser186) Rabbit Polyclonal Antibody (Cy5)
orb955913 100 µL

Phospho-MDM2 (Ser188 + Ser186) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
DNAJC28 Antibody (C-term)
orb1437382-01 50 µL

DNAJC28 Antibody (C-term)

Sign In for Pricing
View Details
DNAJC28 Antibody (C-term)
orb1437382-02 100 µL

DNAJC28 Antibody (C-term)

Sign In for Pricing
View Details
STP22 Antibody
orb851534 2 mg

STP22 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD253 Antibody
DL93282A-01 50 µL

Rabbit anti-CD253 Antibody

Sign In for Pricing
View Details