Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240)

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240) spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMN9 Rabbit Polyclonal Antibody
BT-AP03023-01 20 µL

HMN9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMN9 Rabbit Polyclonal Antibody
BT-AP03023-02 50 µL

HMN9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMN9 Rabbit Polyclonal Antibody
BT-AP03023-03 100 µL

HMN9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Aurora A Antibody (1A14) [Janelia Fluor 646]
NBP2-50041JF646 0.1 mL

Mouse Monoclonal Aurora A Antibody (1A14) [Janelia Fluor 646]

Sign In for Pricing
View Details
OR2AK2 Rabbit Polyclonal Antibody
TA316446 100 µL

OR2AK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXorf67 siRNA Oligos set (Human)
17217171 3x 5 nmol

CXorf67 siRNA Oligos set (Human)

Sign In for Pricing
View Details