Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240)

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240) spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankyrin-1 HDR Plasmid (m2)
sc-419108-HDR-2 20 µg

Ankyrin-1 HDR Plasmid (m2)

Sign In for Pricing
View Details
SLC2A3 Protein Vector (Human) (pPB-C-His)
PV038617 500 ng

SLC2A3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
50nm Gold Nanoparticles, Alkyne Terminated, OD 50, Dispersion in H2O
CGALK-50-50 1 mL

50nm Gold Nanoparticles, Alkyne Terminated, OD 50, Dispersion in H2O

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae rplQ Protein (aa 1-128) (strain PittGG)
VAng-Lsx03739-50gEcoli 50 µg (E. coli)

Recombinant Haemophilus Influenzae rplQ Protein (aa 1-128) (strain PittGG)

Sign In for Pricing
View Details
DHODH Antibody (FITC)
orb414703-01 50 µg

DHODH Antibody (FITC)

Sign In for Pricing
View Details
DHODH Antibody (FITC)
orb414703-02 100 µg

DHODH Antibody (FITC)

Sign In for Pricing
View Details