Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17)

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ataxin 3 (ATXN3) Goat Polyclonal Antibody
AB10089-200 600 µg

Ataxin 3 (ATXN3) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Benzoyl Ecgonine Isopropyl Ester
TRC-B208130-5MG 5 mg

Benzoyl Ecgonine Isopropyl Ester

Sign In for Pricing
View Details
Atholate™, protein hydrolysate, 2.5 kg
0134-2.5 2.5 Kg

Atholate™, protein hydrolysate, 2.5 kg

Sign In for Pricing
View Details
GST-Tag Mouse Monoclonal Antibody [Clone ID: 25A10.D6.D2]
AM06101PU-N 100 µL

GST-Tag Mouse Monoclonal Antibody [Clone ID: 25A10.D6.D2]

Sign In for Pricing
View Details
Isotonitazene BSA Conjugate
50640-AAT 1 mg

Isotonitazene BSA Conjugate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS501044 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details