Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17)

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrobenzonitrile
TRC-N495035-50G 50 g

4-Nitrobenzonitrile

Sign In for Pricing
View Details
Bcl10 Recombinant Rabbit monoclonal Antibody
HA751468 100 µL

Bcl10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1,2-Dehydroprogesterone
TRC-D230330-5MG 5 mg

1,2-Dehydroprogesterone

Sign In for Pricing
View Details
Human C2orf49 activation kit by CRISPRa
GA112349 1 Kit

Human C2orf49 activation kit by CRISPRa

Sign In for Pricing
View Details
(2-Oxopropyl)carbamic Acid tert-Butyl Ester
TRC-O990068-50MG 50 mg

(2-Oxopropyl)carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]
TA505765AM 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]

Sign In for Pricing
View Details