Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18)

This Recombinant Human T cell receptor beta variable 18 (TVB18) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4F14P CRISPR Knock Out 293T Cell Line (Human)
35207141 1x 10^6 Cells / 1.0 mL

OR4F14P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
GLCNE (GNE) (NM_001190388) Human Tagged ORF Clone
RC231391 10 µg

GLCNE (GNE) (NM_001190388) Human Tagged ORF Clone

Sign In for Pricing
View Details
DALRD3
E8ER1907-17 100 µL

DALRD3

Sign In for Pricing
View Details
Human Biliverdin Reductase A (BLVRA) ELISA Kit
RDR-BLVRA-Hu-48Tests 48 Tests

Human Biliverdin Reductase A (BLVRA) ELISA Kit

Sign In for Pricing
View Details
HLA-G (4H84) Alexa Fluor® 488
sc-21799 AF488 200 µg/mL

HLA-G (4H84) Alexa Fluor® 488

Sign In for Pricing
View Details
Albumin, Human Serum (ALB, DKFZp779N1935, PRO0883, PRO0903, PRO1341) (MaxLight 750)
MBS6406144-01 0.1 mL

Albumin, Human Serum (ALB, DKFZp779N1935, PRO0883, PRO0903, PRO1341) (MaxLight 750)

Sign In for Pricing
View Details