Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L)

This Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L) spans the amino acid sequence from region 14-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 6-like, mitochondrial UQCRHL

UniProt

A0A096LP55

Expression Region

14-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBA7 Antibody
E38PA2202 100 µL

UBA7 Antibody

Sign In for Pricing
View Details
Zebrafish ILK Rabbit Polyclonal Antibody (PE)
orb2804898 100 µg

Zebrafish ILK Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody
orb1474751-01 30 µL

Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody
orb1474751-02 50 μL

Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody
orb1474751-03 100 µL

Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody
orb1474751-04 200 µL

Claudin 7 (Phospho-Y210) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details