Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26)

This Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-26 IGKV2D-26

UniProt

A0A0A0MRZ7

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQTPLSLSITPGEQASMSCRSSQSLLHSDGYTYLYWFLQKARPVSTLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQDAQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDSL (B-8) FITC
sc-514341 FITC 200 µg/mL

SDSL (B-8) FITC

Sign In for Pricing
View Details
RS 102895 hydrochloride
2089/50 50 mg

RS 102895 hydrochloride

Sign In for Pricing
View Details
BTNL2 Double Nickase Plasmid (h)
sc-412692-NIC 20 µg

BTNL2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human HCRTR1 Protein, N-GST & C-His
orb3154526-01 50 µg

Recombinant Human HCRTR1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human HCRTR1 Protein, N-GST & C-His
orb3154526-02 100 µg

Recombinant Human HCRTR1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human HCRTR1 Protein, N-GST & C-His
orb3154526-03 1 mg

Recombinant Human HCRTR1 Protein, N-GST & C-His

Sign In for Pricing
View Details