Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-52 (LV552)

This Recombinant Human Immunoglobulin lambda variable 5-52 (LV552) spans the amino acid sequence from region 20-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-52 IGLV5-52

UniProt

A0A0A0MRZ9

Expression Region

20-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPSSHSASSGASVRLTCMLSSGFSVGDFWIRWYQQKPGNPPRYLLYYHSDSNKGQGSGVPSRFSGSNDASANAGILRISGLQPEDEADYYCGTWHSNSKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCA, ID (FANCA, FAA, FACA, FANCH, Fanconi anemia group A protein) (Azide free) (HRP) discontinued
035505-HRP 200 µL

FANCA, ID (FANCA, FAA, FACA, FANCH, Fanconi anemia group A protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Salmonella paratyphi A (APC)
S0060-18B-APC 100 µL

Salmonella paratyphi A (APC)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Probable C4-dicarboxylate sensor kinase (dctS), partial
MBS1046531-01 1 mg (E-Coli)

Recombinant Bacillus subtilis Probable C4-dicarboxylate sensor kinase (dctS), partial

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Probable C4-dicarboxylate sensor kinase (dctS), partial
MBS1046531-02 1 mg (Yeast)

Recombinant Bacillus subtilis Probable C4-dicarboxylate sensor kinase (dctS), partial

Sign In for Pricing
View Details
Human Follistatin Like Protein 3 (FSTL3) ELISA Kit
orb2810971-01 48 Tests

Human Follistatin Like Protein 3 (FSTL3) ELISA Kit

Sign In for Pricing
View Details
Human Follistatin Like Protein 3 (FSTL3) ELISA Kit
orb2810971-02 96 Tests

Human Follistatin Like Protein 3 (FSTL3) ELISA Kit

Sign In for Pricing
View Details