Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-52 (LV552)

This Recombinant Human Immunoglobulin lambda variable 5-52 (LV552) spans the amino acid sequence from region 20-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-52 IGLV5-52

UniProt

A0A0A0MRZ9

Expression Region

20-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPSSHSASSGASVRLTCMLSSGFSVGDFWIRWYQQKPGNPPRYLLYYHSDSNKGQGSGVPSRFSGSNDASANAGILRISGLQPEDEADYYCGTWHSNSKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ERAS Antibody [mFluor Violet 450 SE]
NBP2-99426MFV450 0.1 mL

Rabbit Polyclonal ERAS Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
SERGEF CRISPR All-in-one AAV vector set (with saCas9)(Human)
43426151 3x 1.0 µg DNA

SERGEF CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral mouse 6030498E09Rik shRNA (UAS) - Lentiviral mouse 6030498E09Rik shRNA (UAS, GFP) (100)
GTR15138549 1 Vial

Lentiviral mouse 6030498E09Rik shRNA (UAS) - Lentiviral mouse 6030498E09Rik shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Nori® Guinea Pig IL-12 ELISA Kit
GR171009 96 Well

Nori® Guinea Pig IL-12 ELISA Kit

Sign In for Pricing
View Details
CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)
MBS6412418-01 0.1 mL

CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)

Sign In for Pricing
View Details
CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)
MBS6412418-02 5x 0.1 mL

CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)

Sign In for Pricing
View Details