Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-52 (LV552)

This Recombinant Human Immunoglobulin lambda variable 5-52 (LV552) spans the amino acid sequence from region 20-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-52 IGLV5-52

UniProt

A0A0A0MRZ9

Expression Region

20-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPSSHSASSGASVRLTCMLSSGFSVGDFWIRWYQQKPGNPPRYLLYYHSDSNKGQGSGVPSRFSGSNDASANAGILRISGLQPEDEADYYCGTWHSNSKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC30 (NM_032317) Human 3' UTR Clone
SC216630 10 µg

DNAJC30 (NM_032317) Human 3' UTR Clone

Sign In for Pricing
View Details
Lentiviral human PRSS35 sgRNA gene knockout kit - Lentiviral human PRSS35 sgRNA gene knockout kit (plasmid)
GTR15393143 1 Vial

Lentiviral human PRSS35 sgRNA gene knockout kit - Lentiviral human PRSS35 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CCL22/MDC Polyclonal Antibody
E55A00167 100 µg

CCL22/MDC Polyclonal Antibody

Sign In for Pricing
View Details
PerCP-Cy5.5 anti-mouse CD172a (SIRPα)
E16FMS172a-100U 100 µg

PerCP-Cy5.5 anti-mouse CD172a (SIRPα)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Probable glucose-1-phosphate cytidylyltransferase (yfnH)
MBS1139687-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Probable glucose-1-phosphate cytidylyltransferase (yfnH)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Probable glucose-1-phosphate cytidylyltransferase (yfnH)
MBS1139687-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Probable glucose-1-phosphate cytidylyltransferase (yfnH)

Sign In for Pricing
View Details