Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Itgav Pre-designed siRNA Set B
SI206915B 1 Each

Rat Itgav Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-UNG Rabbit Monoclonal Antibody, Carrier-free
M01672-2-carrier-free 100 µL

Anti-UNG Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Lentiviral human PTPN21 sgRNA gene knockout kit - Lentiviral human PTPN21 sgRNA gene knockout kit (25)
GTR15400575 1 Vial

Lentiviral human PTPN21 sgRNA gene knockout kit - Lentiviral human PTPN21 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SARS, CT (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA (Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS) (MaxLight 750) discontinued
S1009-30A-ML750 100 µL

SARS, CT (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA (Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-PAP/ACP3 Antibody Picoband®, PE Conjugate
A02082-2-PE 100 µg/Vial

Anti-PAP/ACP3 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
BHI Agar + 500 mg/l Gentamicin 10 x 90 mm Petri
TMB_BHIGEN_P90_10 10 x 90 mm Petri

BHI Agar + 500 mg/l Gentamicin 10 x 90 mm Petri

Sign In for Pricing
View Details