Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kylt® Streptococcus suis 2
31384 100 Reactions

Kylt® Streptococcus suis 2

Sign In for Pricing
View Details
Recombinant Ceratotherium simum Cytochrome c oxidase subunit 2 (MT-CO2)
orb2928594-01 20 µg

Recombinant Ceratotherium simum Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details
Recombinant Ceratotherium simum Cytochrome c oxidase subunit 2 (MT-CO2)
orb2928594-02 100 µg

Recombinant Ceratotherium simum Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details
Lentiviral mouse Dkk2 shRNA (UAS) - Lentiviral mouse Dkk2 shRNA (UAS) (25)
GTR15276869 1 Vial

Lentiviral mouse Dkk2 shRNA (UAS) - Lentiviral mouse Dkk2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral mouse Chd4 shRNA (UAS) - Lentiviral mouse Chd4 shRNA (UAS, iRFP) (25)
GTR15196466 1 Vial

Lentiviral mouse Chd4 shRNA (UAS) - Lentiviral mouse Chd4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Heparanase (HPA) Recombinant, Human
155023-01 10 µg

Heparanase (HPA) Recombinant, Human

Sign In for Pricing
View Details