Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR26 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV625592 1.0 µg DNA

GPR26 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SERPINA3 (Alpha-1-antichymotrypsin, ACT, Cell Growth-inhibiting Gene 24/25 Protein, Serpin A3, AACT, GIG24, GIG25) (AP)
MBS6393706-01 0.1 mL

SERPINA3 (Alpha-1-antichymotrypsin, ACT, Cell Growth-inhibiting Gene 24/25 Protein, Serpin A3, AACT, GIG24, GIG25) (AP)

Sign In for Pricing
View Details
SERPINA3 (Alpha-1-antichymotrypsin, ACT, Cell Growth-inhibiting Gene 24/25 Protein, Serpin A3, AACT, GIG24, GIG25) (AP)
MBS6393706-02 5x 0.1 mL

SERPINA3 (Alpha-1-antichymotrypsin, ACT, Cell Growth-inhibiting Gene 24/25 Protein, Serpin A3, AACT, GIG24, GIG25) (AP)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) rplI Polyclonal Antibody
MBS7175582 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) rplI Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD172a/SIRPA Protein, C-mFc (IgG2a) (Active)
AHF64004 100 μg

Recombinant Human CD172a/SIRPA Protein, C-mFc (IgG2a) (Active)

Sign In for Pricing
View Details
Macrophage Scavenger Receptor I (MSR1) Mouse Monoclonal Antibody [Clone ID: UMLBI246]
AMM21982VCF 100 µg

Macrophage Scavenger Receptor I (MSR1) Mouse Monoclonal Antibody [Clone ID: UMLBI246]

Sign In for Pricing
View Details