Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf135 (AUNIP) Human qPCR Primer Pair (NM_024037)
HP214698 200 Reactions

C1orf135 (AUNIP) Human qPCR Primer Pair (NM_024037)

Sign In for Pricing
View Details
Dog IL1 BETA protein
orb435751 5 µg

Dog IL1 BETA protein

Sign In for Pricing
View Details
C1orf94 Protein Vector (Human) (pPM-C-His)
PV005820 500 ng

C1orf94 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-PRKY (H93) Antibody
A14965-1 100 µL

Anti-PRKY (H93) Antibody

Sign In for Pricing
View Details
pLV3×FLAG-CopGFP-Puro Plasmid
PVT59906 2 µg

pLV3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
RAI14 Antibody
orb1244415 100 µL

RAI14 Antibody

Sign In for Pricing
View Details