Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details