Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Mitochondrial import receptor subunit TOM7 homolog (TOMM7) ELISA Kit
GTR10324002 96 Well

Porcine Mitochondrial import receptor subunit TOM7 homolog (TOMM7) ELISA Kit

Sign In for Pricing
View Details
TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (MaxLight 750) discontinued
134704-ML750 100 µL

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DAXX Rabbit Polyclonal Antibody
TA357674 100 µL

DAXX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-1 beta, human recombinant
4128-10 10 µg

IL-1 beta, human recombinant

Sign In for Pricing
View Details
Electrode Plates For Simple Cells
1090360/1 1 Each

Electrode Plates For Simple Cells

Sign In for Pricing
View Details
Anti-GABARAPL1 Polyclonal Antibody
TMAB-06247-01 50 μL

Anti-GABARAPL1 Polyclonal Antibody

Sign In for Pricing
View Details