Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAGEA4 Antibody
A1705-100 100 µL

Anti-MAGEA4 Antibody

Sign In for Pricing
View Details
Human Malonyl coenzyme A,Malonyl COA ELISA KIT
JOT-EK5628Hu-01 96 Well

Human Malonyl coenzyme A,Malonyl COA ELISA KIT

Sign In for Pricing
View Details
Human Malonyl coenzyme A,Malonyl COA ELISA KIT
JOT-EK5628Hu-02 48 Well

Human Malonyl coenzyme A,Malonyl COA ELISA KIT

Sign In for Pricing
View Details
1-Fluoro-3- (1-methylethenyl) benzene
PC1021492-01 250 mg

1-Fluoro-3- (1-methylethenyl) benzene

Sign In for Pricing
View Details
1-Fluoro-3- (1-methylethenyl) benzene
PC1021492-02 500 mg

1-Fluoro-3- (1-methylethenyl) benzene

Sign In for Pricing
View Details
CEACAM6/CD66c (tinurilimab) discontinued
047711 100 µg

CEACAM6/CD66c (tinurilimab) discontinued

Sign In for Pricing
View Details