Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krt40 3'UTR Lenti-reporter-Luc Vector
26029084 1.0 µg

Krt40 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human GABRG3 Knockout A549 cell line
GTR15405523 1 Vial

Human GABRG3 Knockout A549 cell line

Sign In for Pricing
View Details
Biotin Anti-Mouse CD54 Antibody
JOT20341F 50μg

Biotin Anti-Mouse CD54 Antibody

Sign In for Pricing
View Details
Lentiviral human CYB561D2 shRNA (UAS) - Lentiviral human CYB561D2 shRNA (UAS, iRFP) plasmid
GTR15327103 1 Vial

Lentiviral human CYB561D2 shRNA (UAS) - Lentiviral human CYB561D2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Z-FA-FMK
C12655-1mg 1 mg

Z-FA-FMK

Sign In for Pricing
View Details
Human LMX1A (NM_177398) AAV Particle
RC215375A1V 250 µL

Human LMX1A (NM_177398) AAV Particle

Sign In for Pricing
View Details