Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXN1 Polyclonal Antibody
E55A02821 100 µg

UBXN1 Polyclonal Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor-8 Mouse Recombinant (FGF 8 Mouse)
PT_74128-01 5 µg

Fibroblast Growth Factor-8 Mouse Recombinant (FGF 8 Mouse)

Sign In for Pricing
View Details
Fibroblast Growth Factor-8 Mouse Recombinant (FGF 8 Mouse)
PT_74128-02 25 µg

Fibroblast Growth Factor-8 Mouse Recombinant (FGF 8 Mouse)

Sign In for Pricing
View Details
Fibroblast Growth Factor-8 Mouse Recombinant (FGF 8 Mouse)
PT_74128-03 1 mg

Fibroblast Growth Factor-8 Mouse Recombinant (FGF 8 Mouse)

Sign In for Pricing
View Details
LSM3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-18428R-BF680 100 µL

LSM3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
GDE3 Rabbit Polyclonal Antibody (BF555)
orb2378410 100 µL

GDE3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details