Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb9c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3179707 1.0 µg DNA

Serpinb9c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
FAIM Antibody
A48695-50UL 50 μL

FAIM Antibody

Sign In for Pricing
View Details
M/M008/NT-PP-PHOLUMC-Dia 150/1-B Personal Protection (PPE) Signs (No Adhesive)
835655 1 Pack (1 Panel (s) x 1 Pack)

M/M008/NT-PP-PHOLUMC-Dia 150/1-B Personal Protection (PPE) Signs (No Adhesive)

Sign In for Pricing
View Details
Rabbit Monoclonal CDX2 Antibody (CDX2/4394R) [FITC]
NBP3-08743F 100 µL

Rabbit Monoclonal CDX2 Antibody (CDX2/4394R) [FITC]

Sign In for Pricing
View Details
Rabbit Monoclonal pIgR Antibody (040) [Alexa Fluor 532]
NBP2-90428AF532 0.1 mL

Rabbit Monoclonal pIgR Antibody (040) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Olfactory receptor 56A4 (OR56A4) ELISA Kit
MBS7214820-01 48 Well

Rabbit Olfactory receptor 56A4 (OR56A4) ELISA Kit

Sign In for Pricing
View Details