Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57)

This Recombinant Human Probable non-functional T cell receptor beta variable 5-7 (TVB57) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-7 TRBV5-7

UniProt

A0A0A0MS05

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQHVTLRCSPISGHTSVSSYQQALGQGPQFIFQYYEKEERGRGNFPDQFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPAB CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23740154 3x 1.0 µg DNA

HNRNPAB CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MSH6 Antibody
orb1712232 7 mL

MSH6 Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human BIK (BCL2 interacting killer) Expressed in vitro E.coli expression system, Full Length
MPX1218K Each

Magic™ Membrane Protein Human BIK (BCL2 interacting killer) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Clock Antibody
8C10086-AAT 50 µg

Clock Antibody

Sign In for Pricing
View Details
EGFR Antibody (phospho-S768)
F48553-0.08ML 0.08 mL

EGFR Antibody (phospho-S768)

Sign In for Pricing
View Details
AVPR1A Rabbit pAb, Pacific Blue conjugated
orb2865300 100 µL

AVPR1A Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details