Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23)

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Hydroxy-5-iodo-7-oxabicyclo[2.2.1]heptane-2-carboxylic Acid Gamma-Lactone
TRC-H943640-10MG 10 mg

6-Hydroxy-5-iodo-7-oxabicyclo[2.2.1]heptane-2-carboxylic Acid Gamma-Lactone

Sign In for Pricing
View Details
ENaC beta Antibody: PerCP
SMC-241D-PCP 100 µg

ENaC beta Antibody: PerCP

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), 0.2mg/mL
BNUB1778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), 0.2mg/mL

Sign In for Pricing
View Details
Anti-Mouse CD40 (FGK4.5) In Vivo Antibody - Low Endotoxin
ICH1073-25mg 25 mg

Anti-Mouse CD40 (FGK4.5) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
ACBD4 (NM_001135707) Human Over-expression Lysate
LC427681 20 µg

ACBD4 (NM_001135707) Human Over-expression Lysate

Sign In for Pricing
View Details
Isovaleric Acid Ethyl-d5 Ester
TRC-I917577-25MG 25 mg

Isovaleric Acid Ethyl-d5 Ester

Sign In for Pricing
View Details