Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23)

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin A Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4937R-BF647 100 µL

Cystatin A Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Tubing Simax 54Mm X 2.5Mm 12.2Kg
T/54/2.5 1 Each

Tubing Simax 54Mm X 2.5Mm 12.2Kg

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)
MBS2166572-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)
MBS2166572-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)
MBS2166572-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)
MBS2166572-04 1 mL

Cy3-Linked Monoclonal Antibody to Cluster Of Differentiation 226 (CD226)

Sign In for Pricing
View Details