Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145)

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGFAC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0949007 1.0 µg DNA

HGFAC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GPN2 Protein Vector (Human) (pPB-N-His)
PV018354 500 ng

GPN2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
LAGE3 Protein Vector (Rat) (pPB-C-His)
PV277002 500 ng

LAGE3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
p21-ARC antibody
MBS9411817-01 0.1 mL

p21-ARC antibody

Sign In for Pricing
View Details
p21-ARC antibody
MBS9411817-02 5x 0.1 mL

p21-ARC antibody

Sign In for Pricing
View Details
PP2A-B56-α discontinued
345428-01 100 µL

PP2A-B56-α discontinued

Sign In for Pricing
View Details