Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145)

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Epstein Barr Virus Antibody (15F9) [DyLight 594]
NB100-66574DL594 0.125 mL

Rat Monoclonal Epstein Barr Virus Antibody (15F9) [DyLight 594]

Sign In for Pricing
View Details
Recombinant human DNAM-1/CD226 protein
ATGP3475-050 50 µg

Recombinant human DNAM-1/CD226 protein

Sign In for Pricing
View Details
CEP70 Polyclonal Antibody
MBS9243075-01 0.1 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
CEP70 Polyclonal Antibody
MBS9243075-02 5x 0.1 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
HAPLN2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11051R-BF680 100 µL

HAPLN2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HEXDC ORF Vector (Human) (pORF)
23223011 1.0 µg DNA

HEXDC ORF Vector (Human) (pORF)

Sign In for Pricing
View Details