Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145)

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf63 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0256905 3x 1.0 µg

C7orf63 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
NT5C (5' (3') -deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (PE)
130594-PE 100 µL

NT5C (5' (3') -deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (PE)

Sign In for Pricing
View Details
TNNI3 Rabbit pAb
MBS8543918-01 0.1 mL

TNNI3 Rabbit pAb

Sign In for Pricing
View Details
TNNI3 Rabbit pAb
MBS8543918-02 0.1 mL (AF405L)

TNNI3 Rabbit pAb

Sign In for Pricing
View Details
TNNI3 Rabbit pAb
MBS8543918-03 0.1 mL (AF405S)

TNNI3 Rabbit pAb

Sign In for Pricing
View Details
TNNI3 Rabbit pAb
MBS8543918-04 0.1 mL (AF610)

TNNI3 Rabbit pAb

Sign In for Pricing
View Details