Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14)

This Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 14/delta variable 4 TRAV14DV4

UniProt

A0A0A6YYC5

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uhrf2 Rabbit Polyclonal Antibody (HRP)
orb2134371 100 µL

Uhrf2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NACC1 Protein Vector (Mouse) (pPM-C-His)
PV203961 500 ng

NACC1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
R3HCC1 Polyclonal Antibody
orb1418005 100 µL

R3HCC1 Polyclonal Antibody

Sign In for Pricing
View Details
mmu-miR-3112-5p miRNA Agomir
MBS8314098-01 5 nmol

mmu-miR-3112-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3112-5p miRNA Agomir
MBS8314098-02 10 nmol

mmu-miR-3112-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3112-5p miRNA Agomir
MBS8314098-03 20 nmol

mmu-miR-3112-5p miRNA Agomir

Sign In for Pricing
View Details