Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 13 (TVB13)

This Recombinant Human T cell receptor beta variable 13 (TVB13) spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 13 TRBV13

UniProt

A0A0A6YYD4

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-17B Antibody (MM0373-3D62) [DyLight 755]
NBP2-11672IR 0.1 mL

Mouse Monoclonal IL-17B Antibody (MM0373-3D62) [DyLight 755]

Sign In for Pricing
View Details
DBCO-PEG4-Val-Cit-PAB-MMAF
T39748-01 100 mg

DBCO-PEG4-Val-Cit-PAB-MMAF

Sign In for Pricing
View Details
DBCO-PEG4-Val-Cit-PAB-MMAF
T39748-02 500 mg

DBCO-PEG4-Val-Cit-PAB-MMAF

Sign In for Pricing
View Details
TRAV15 ORF Vector (Human) (pORF)
47546011 1.0 µg DNA

TRAV15 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FOLR3 Mouse Monoclonal Antibody
BF8896-01 100 µL

FOLR3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
FOLR3 Mouse Monoclonal Antibody
BF8896-02 200 µL

FOLR3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details