Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 13 (TVB13)

This Recombinant Human T cell receptor beta variable 13 (TVB13) spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 13 TRBV13

UniProt

A0A0A6YYD4

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Jmjd4 Pre-designed siRNA Set B
SI206988B 1 Each

Rat Jmjd4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GGPS1 Peptide
DF12617-BP 1 mg

GGPS1 Peptide

Sign In for Pricing
View Details
Neuropeptide Y Receptor Y2 (NPY2R) Magnetic Luminex Assay Kit
LKU600559 96 Tests

Neuropeptide Y Receptor Y2 (NPY2R) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
StARD5 (H-4) Alexa Fluor® 594
sc-514236 AF594 200 µg/mL

StARD5 (H-4) Alexa Fluor® 594

Sign In for Pricing
View Details
Stc1-set siRNA/shRNA/RNAi Lentivector (Rat)
45706096 4x 500 ng

Stc1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Caspase-8 subunit p18 Rabbit Polyclonal Antibody (BF488)
orb1590086 100 µL

Caspase-8 subunit p18 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details