Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66)

This Recombinant Human T cell receptor beta variable 6-6 (TVB66) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPSNAP3A 3'UTR GFP Stable Cell Line
TU065699 1.0 mL

NIPSNAP3A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LOC686031 3'UTR Luciferase Stable Cell Line
TU211368 1.0 mL

LOC686031 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EGR3 Recombinant Protein (Rat)
RP199226 100 µg

EGR3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CD63 (NK1/C3) : m-IgG1 BP-HRP Bundle
sc-532300 1 Kit

CD63 (NK1/C3) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
J-137-7425J Pre-sized Labels for Printers
176611 1000 Box (1000 Label (s) x 1 Roll)

J-137-7425J Pre-sized Labels for Printers

Sign In for Pricing
View Details
Nutlin-3
1842-1 1 mg

Nutlin-3

Sign In for Pricing
View Details