Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83)

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACCSL (NM_001031854) Human Recombinant Protein
PH34443M5 20 µg

ACCSL (NM_001031854) Human Recombinant Protein

Sign In for Pricing
View Details
1- (2,4-Difluorophenyl) -2,2-difluoroethanone
PC1024260 1 Each

1- (2,4-Difluorophenyl) -2,2-difluoroethanone

Sign In for Pricing
View Details
(3R) -3-Ethyl-1,4-diazepan-2-one
XLB17862-01 50 mg

(3R) -3-Ethyl-1,4-diazepan-2-one

Sign In for Pricing
View Details
(3R) -3-Ethyl-1,4-diazepan-2-one
XLB17862-02 0.5 g

(3R) -3-Ethyl-1,4-diazepan-2-one

Sign In for Pricing
View Details
Human anti-IgA antibody Elisa Kit
EK710916 96 Well

Human anti-IgA antibody Elisa Kit

Sign In for Pricing
View Details
Olfactory receptor 8S1 Polyclonal Antibody
MBS8524433-01 0.1 mg

Olfactory receptor 8S1 Polyclonal Antibody

Sign In for Pricing
View Details