Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-1 (TVB71)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-1 (TVB71) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-1 TRBV7-1

UniProt

A0A0A6YYK4

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSLRHKVAKKGKDVALRYDPISGHNALYWYRQSLGQGLEFPIYFQGKDAADKSGLPRDRFSAQRSEGSISTLKFQRTQQGDLAVYLCASSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti- Serine/threonine-protein kinase PAK 6 Antibody
GWB-508965 0.05 mL

Anti- Serine/threonine-protein kinase PAK 6 Antibody

Sign In for Pricing
View Details
Bim Rabbit pAb, PE-Cy7 conjugated
orb2839697 100 µL

Bim Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Rat Monoclonal CD40 Ligand/TNFSF5 Antibody (208109) [Biotin]
FAB1163B 0.5 mL

Rat Monoclonal CD40 Ligand/TNFSF5 Antibody (208109) [Biotin]

Sign In for Pricing
View Details
RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)
MBS6184835-01 0.1 mL

RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)

Sign In for Pricing
View Details
RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)
MBS6184835-02 5x 0.1 mL

RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)

Sign In for Pricing
View Details
GEM144
C04944-5mg 5 mg

GEM144

Sign In for Pricing
View Details