Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 16 (TVA16)

This Recombinant Human T cell receptor alpha variable 16 (TVA16) spans the amino acid sequence from region 21-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 16 TRAV16

UniProt

A0A0A6YYK6

Expression Region

21-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUN (Transcription Factor AP-1, Jun Proto-oncogene)
483851 100 µL

JUN (Transcription Factor AP-1, Jun Proto-oncogene)

Sign In for Pricing
View Details
RPL7P35 CRISPRa sgRNA lentivector (set of three targets)(Human)
41895121 3x 1.0µg DNA

RPL7P35 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Ascl3 Antibody
OAEB01062-100UG 100 µg

Ascl3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Rictor Antibody [DyLight 350]
NB100-611UV 100 µL

Rabbit Polyclonal Rictor Antibody [DyLight 350]

Sign In for Pricing
View Details
CVT-313
HY-15339-01 10 mM - 1 mL

CVT-313

Sign In for Pricing
View Details
CVT-313
HY-15339-02 5 mg

CVT-313

Sign In for Pricing
View Details