Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19)

This Recombinant Human T cell receptor alpha variable 19 (TVA19) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C-C Motif Chemokine 18/CCL18/PARC Protein (N-6His)
E53A06159 50 µg

Recombinant Human C-C Motif Chemokine 18/CCL18/PARC Protein (N-6His)

Sign In for Pricing
View Details
StemFate?-4 CFC/CFU Differentiation Assay Kit for Human Cells I
K3101-50 each

StemFate?-4 CFC/CFU Differentiation Assay Kit for Human Cells I

Sign In for Pricing
View Details
Mis18a sgRNA CRISPR Lentivector (Rat) (Target 3)
K7613804 1.0 µg DNA

Mis18a sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
NCOA4 Protein Vector (Mouse) (pPB-C-His)
PV204418 500 ng

NCOA4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Aif1 (HRP)
554740-01 50 µg

Aif1 (HRP)

Sign In for Pricing
View Details
Aif1 (HRP)
554740-02 100 µg

Aif1 (HRP)

Sign In for Pricing
View Details