Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601)

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601) spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BioFastspin Plant Genomic DNA Extraction Kit
TRI-C18S1 50T

BioFastspin Plant Genomic DNA Extraction Kit

Sign In for Pricing
View Details
TMP-CP
BLG-T008-05 5 μmoL

TMP-CP

Sign In for Pricing
View Details
Anti-Annexin VII/ANXA7 Antibody Picoband® (Dylight488 Conjugate)
PA2076-Dylight488 100 µg

Anti-Annexin VII/ANXA7 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Zebrafish hspa8 Antibody (C-term)
orb2996702-01 50 µL

Zebrafish hspa8 Antibody (C-term)

Sign In for Pricing
View Details
Zebrafish hspa8 Antibody (C-term)
orb2996702-02 100 µL

Zebrafish hspa8 Antibody (C-term)

Sign In for Pricing
View Details
Klrg1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3978006 1.0 µg DNA

Klrg1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details